PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G139100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 495aa    MW: 52729.8 Da    PI: 5.8495
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G139100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3497.4e-107784541374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                         lv+lL++c  a+++gd ++a+  La+ + + a  +  + m R+a++f+ ALa+rl+   ++ +   pp +     ++ ++  ++ f+++ P
  Sevir.3G139100.1.p  78 LVHLLVTCTGAIQAGDYSAAHGNLAEARSIlAVIATsTGMGRVATHFADALAQRLFPAYPNAA---PPAPP----HTATAEQYSHFYDAGP 161
                         68**************************99755555599*****************9333333...33333....3455666888****** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         +l+f++ taNqaIl+a+eg++rvH++Df ++qGlQWp+L++aL++R++gpp+lRiTg+g++ +g  +el+e+g rLa+fA++lgvpf f+ 
  Sevir.3G139100.1.p 162 YLNFAYSTANQAILDAFEGCDRVHVVDFALMQGLQWPSLIHALSKREGGPPRLRITGIGPHPTGAGDELREVGIRLAEFARSLGVPFCFRG 252
                         ************************************************************9999*************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                         + +++l+ l+ ++L++ pgEala n+++qlhrll ++ + +    ++d +L+lv +l+P++++vveqeadhn++++lerf++al +y+a+f
  Sevir.3G139100.1.p 253 VCVDQLDGLSKWMLKIVPGEALAFNSIMQLHRLLVDPDADPAvpaPIDILLDLVTELQPRIFTVVEQEADHNRPPLLERFTNALFHYAAMF 343
                         *********************************96655544444499******************************************** PP

                GRAS 269 dsl.eak.lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll.rkvk..sdgyrveee 354
                         ds+ +a+  ++  +   ++ +++l+ ei ++v+ eg++r erhe l++Wrerl +aG+++v ++ +++  a + l + ++  +dgy++ e 
  Sevir.3G139100.1.p 344 DSMvAAGnHAAGGSSTCSLAEAYLRSEIFDIVCGEGSARAERHELLGRWRERLARAGLTQVLFGPNEVRLATAQLiSATSfsGDGYSILEC 434
                         ***74441444448889999999*****************************************999876665441333334899****** PP

                GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                          gsl l W+drpL++++aWr
  Sevir.3G139100.1.p 435 AGSLALAWHDRPLYAATAWR 454
                         *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.34552431IPR005202Transcription factor GRAS
PfamPF035142.5E-10478454IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MGLIPFSWLP MEPAAAATFT GGIPPPFPAA ADNGAAYCID PTTLLASLLP PGRQPAVPAA  60
AEAARRRQEE EEAAAIRLVH LLVTCTGAIQ AGDYSAAHGN LAEARSILAV IATSTGMGRV  120
ATHFADALAQ RLFPAYPNAA PPAPPHTATA EQYSHFYDAG PYLNFAYSTA NQAILDAFEG  180
CDRVHVVDFA LMQGLQWPSL IHALSKREGG PPRLRITGIG PHPTGAGDEL REVGIRLAEF  240
ARSLGVPFCF RGVCVDQLDG LSKWMLKIVP GEALAFNSIM QLHRLLVDPD ADPAVPAPID  300
ILLDLVTELQ PRIFTVVEQE ADHNRPPLLE RFTNALFHYA AMFDSMVAAG NHAAGGSSTC  360
SLAEAYLRSE IFDIVCGEGS ARAERHELLG RWRERLARAG LTQVLFGPNE VRLATAQLIS  420
ATSFSGDGYS ILECAGSLAL AWHDRPLYAA TAWRAAGGGS AASAVAHDEW RDDGRRRARN  480
GGRESYGFGN LAIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-43784544375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963578.10.0PREDICTED: DELLA protein DWARF8-like
TrEMBLK3ZCZ80.0K3ZCZ8_SETIT; Uncharacterized protein
STRINGSi024429m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.12e-83GRAS family protein